Basic Information | |
---|---|
Taxon OID | 3300025597 Open in IMG/M |
Scaffold ID | Ga0208825_1057475 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1042 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hong Kong | |||||||
Coordinates | Lat. (o) | 22.28 | Long. (o) | 114.17 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082560 | Metagenome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208825_10574752 | F082560 | GGAGG | MTEKAIVKKIQEWFKTKGGVCHKVHGGPLSAGFPDLIGCIEADAWVVEVKVPNAKPRVPKELRERLPKEMREWMGKGATMLQAKTLYDWQCAGAIAMVATSVEDVERRYQEEYFGSNIGGKHYGGFKRTQ |
⦗Top⦘ |