NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208248_1023873

Scaffold Ga0208248_1023873


Overview

Basic Information
Taxon OID3300025595 Open in IMG/M
Scaffold IDGa0208248_1023873 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1448
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025975Metagenome / Metatranscriptome199Y
F048255Metagenome / Metatranscriptome148Y
F090296Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0208248_10238731F048255N/AMAAKTITIEMADDGSITVSTSEGGEPYECKDIAECRKYVDMMLSEEQGESPEEQSTEGPEDYSKMWNQEAKSRQPQPGLMA
Ga0208248_10238732F025975GGAGMEQNYANPASRNTMRAAGGMTANSAKMPGGPVGSNQTQGAGQIPGKVSVPMPGTDATQSPYTGGMAKTPVGFNNGIINGMI
Ga0208248_10238735F090296AGGAGMASRRNPSRAADLAGAPPKLATLADLAIPTDVDTGHRHARQRASKKPMGINLKAVAEACVDEGLDPAVEIAKALKATIPMCRNGQQVFDDKGLPVMVPLLDVDTRMRTLNEFLQYTQPKLKSVEVKMSGSLDLTSEQLDNRLNMLLAKATTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.