Scaffold Ga0209225_1054948

Overview

Basic Information

• Taxon OID: 3300025546
• Scaffold ID: Ga0209225_1054948
• Source Dataset Name: Sulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1131
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Washburn Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026923	Metagenome	196	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209225_10549481	F026923	N/A	RIFSEVEHEIRKEVVKLLPYPFVKLTLVSFCLHKTVDNKYVVVLKYKADVGYLDLSDTKDIDVVIRSDGTYAVL