NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210061_1001387

Scaffold Ga0210061_1001387


Overview

Basic Information
Taxon OID3300025537 Open in IMG/M
Scaffold IDGa0210061_1001387 Open in IMG/M
Source Dataset NameWetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3755
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: San Francisco Bay, California
CoordinatesLat. (o)38.05241603Long. (o)-121.76907401Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031394Metagenome182Y
F068786Metagenome / Metatranscriptome124Y
F093804Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0210061_10013871F031394N/AMKKSVFTFGLLTISLVMIAVMPILNNNHSFANTAIAQKYDKYGNSSYSQYPTDDKKYECRTGPFEGFFVSS
Ga0210061_10013872F093804AGGTGGMANSSAKPVDDLRNRSLKKIGELDLKTFESNKEKEIEIKSEKKQKLEKWHVYLDTNMGHLRKWKDTN
Ga0210061_10013873F068786N/AMSEKKVDLVNSSEVQVMKEKEKDFIDIDVQRLEEGKYYRVEYEGDVYAVEKSTDDKIVFYEVVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.