Basic Information | |
---|---|
Taxon OID | 3300025522 Open in IMG/M |
Scaffold ID | Ga0208371_1021881 Open in IMG/M |
Source Dataset Name | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_1A (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1157 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California, McLaughlin Reserve | |||||||
Coordinates | Lat. (o) | 38.8739528 | Long. (o) | -122.4391613 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102634 | Metagenome / Metatranscriptome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208371_10218812 | F102634 | AGGAG | MDTTIKKRVEIEGYGKLDGEFIQNEQGWFCREVNGVRWNFREWGDQAAMETPEEAALYLLSLDVVDEPEP |
⦗Top⦘ |