NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209012_1004892

Scaffold Ga0209012_1004892


Overview

Basic Information
Taxon OID3300025503 Open in IMG/M
Scaffold IDGa0209012_1004892 Open in IMG/M
Source Dataset NameFerric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8723
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005824Metagenome / Metatranscriptome389Y
F025415Metagenome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0209012_100489210F025415GAGVTPDGVVELVALINAVDEEGTDPDGEAWLAWRRSHEDQGLGCAPIPPTELTRMETTEDPDELRAIVESVILADRRIKQGPPS
Ga0209012_10048929F005824AGCAGGMSTTRSQLYRFARDLGNVEAFEHGYKRGGLGGGAQGEMERQARRVIYREGNRQINKFVRAIGLGPRRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.