Scaffold Ga0209046_1035062

Overview

Basic Information

• Taxon OID: 3300025452
• Scaffold ID: Ga0209046_1035062
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_200m_DNA (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1063
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet, British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077377	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209046_10350622	F077377	N/A	MRATRKEFEDGQQDEVLTNQRDGRVYKKLKWTALHTSKCIQEAVFLLKEEEPSLSKEQLKKMLQAESVSIWFPYGVRKVEKALSVNGSAFHQRGWDRLGRGEPRFSGDSSTWPANHMAAVSLNSNCFKKE