Scaffold Ga0208036_1000666

Overview

Basic Information

• Taxon OID: 3300025419
• Scaffold ID: Ga0208036_1000666
• Source Dataset Name: Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 18415
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (82.35%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828
  • Depth (m): 1 to 1.25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006709	Metagenome	366	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208036_10006664	F006709	AGG	LDPPWPEDYRMKLAGFLLLPAGWGIVLSAVVLLASALPRGCFILAGMGVEVMGLILVVRSHLLLRGERG