Basic Information | |
---|---|
Taxon OID | 3300025412 Open in IMG/M |
Scaffold ID | Ga0208194_1049106 Open in IMG/M |
Source Dataset Name | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 652 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Minnesota | |||||||
Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | .1 to .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042687 | Metagenome / Metatranscriptome | 157 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208194_10491061 | F042687 | GAGG | VEELRKPIGRRSLLKAGGFVAASGALGSVWTLVTGTGADASTSGKVRKRARWIKAVDRPTLSETNADYKRFSGFDMFALYRPLKTQREGTGSFEAEQASKNKRLAVWTNENKPGFSLPDRQLSEGGFTVMH |
⦗Top⦘ |