Scaffold Ga0209825_1000861

Overview

Basic Information

• Taxon OID: 3300025394
• Scaffold ID: Ga0209825_1000861
• Source Dataset Name: Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8B Hudson Canyon (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16914
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → unclassified Oceanospirillaceae → Oceanospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location

• Location Name: Hudson Canyon
• Coordinates
  • Lat. (^o): 39.29
  • Long. (^o): -72.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061294	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209825_10008617	F061294	AGGTGG	MQAIESFESRCVEYQTQSRITQDTIALTVYLQSHQVIYSQIDYMLPEHPPSVEMLAIMVKDVCQGDSFYTYVFEEITHRYIELVGDIGVSPQVIFYYVSNVIISLLVLRRNNSQLSTEILIKIIQRFNFRDTTLRAGIEVIAEEVLRRCFVSINESNSRSFA