NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208041_1003147

Scaffold Ga0208041_1003147


Overview

Basic Information
Taxon OID3300025393 Open in IMG/M
Scaffold IDGa0208041_1003147 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7605
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameChina: Chengdu, Sichuan
CoordinatesLat. (o)30.66Long. (o)104.06Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072352Metagenome / Metatranscriptome121Y
F080011Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0208041_100314711F072352GGGGGMSSKTFRIADLRRSPTVVHLPCCKNGCGEMLALDDGWQCPICNWYRGYYRGERHP
Ga0208041_100314712F080011AGGAGGMTWDELEELRDRLSYILERERAEDGFCPIEDDYYVQYRQAARRAVQDIDPDHSRDRDRYQTLQEIYDAVREIYDIRSAKLRIAVQDRVVFRRDVDRPENLTVEEQERYDMAISLGGHNVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.