NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208503_1006900

Scaffold Ga0208503_1006900


Overview

Basic Information
Taxon OID3300025388 Open in IMG/M
Scaffold IDGa0208503_1006900 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1427
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019779Metagenome / Metatranscriptome227N
F031758Metagenome / Metatranscriptome181N
F039102Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0208503_10069001F039102N/AMNKDQEKERLIRNLFKAIDNLDSTESKETISQAATRIYHLKREIVKMDPTWRVRDPYNYYVHRILSLLDGIDTRENPNVHNNQELYLKLFHETRMIRKTNQSWRLNVSRLVEFMTETSKVTHPDRIEPMETEEVSKPSSSN
Ga0208503_10069002F019779AGAAGMKDHPAIDFIPMDVEGEEVRFPETLDSPSIENEIECSGERCFTPPEDDWEVISRGSDFIIHGLETLDEQLDIIATRIDTENKTEEILKNIRKGFSIIDDIVLYTTTFINEANKAKVEKFKGFISDLLDFAKTNITKTLVIVRKLRARSLLSLIPLTKDLIMEQKHIKKLVSSSNLEQVKELLKEYRCTIRRRVSRRYSI
Ga0208503_10069003F031758N/AVILQVRNTKKRILEIDPNWKLGNKYFNYVHKVISLIDEINTLDEINLEKQRKTFRKILKTTKALRQTDQLWRMNPTIILEFLKWNSKTIMSAEQVSRKPREQVPLN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.