Basic Information | |
---|---|
Taxon OID | 3300025327 Open in IMG/M |
Scaffold ID | Ga0209751_11334479 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 512 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, Colorado, United States | |||||||
Coordinates | Lat. (o) | 39.53 | Long. (o) | -107.78 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069779 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209751_113344792 | F069779 | GAG | VCRALRVLCVAEDAQALSVLKRATVSAEWELVAGATDEAEAMRQLHEERPQVVVVFGAFEGFVARALEAYPALRVVADRDLPGANAVVRETEEVRAAVLGRTHPGGPVGPGRPGGSGV |
⦗Top⦘ |