Scaffold Ga0209341_10161696

Overview

Basic Information

• Taxon OID: 3300025325
• Scaffold ID: Ga0209341_10161696
• Source Dataset Name: Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1882
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047144	Metagenome / Metatranscriptome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209341_101616961	F047144	N/A	PADPLAGLPGHPQSAWKRDVLAALVERAVAALGEPG