Scaffold Ga0209171_10579502

Overview

Basic Information

• Taxon OID: 3300025320
• Scaffold ID: Ga0209171_10579502
• Source Dataset Name: Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 543
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: Banff
• Coordinates
  • Lat. (^o): 51.1699
  • Long. (^o): -116.1578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011166	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209171_105795022	F011166	AGGAGG	VKKIINLWKASVAWAKSLHRDAALDSLRNVLAVVGGATILADFDTIKVWLILPMLAIAFLIWFLDYERHFHGQTVE