NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209172_10002716

Scaffold Ga0209172_10002716


Overview

Basic Information
Taxon OID3300025310 Open in IMG/M
Scaffold IDGa0209172_10002716 Open in IMG/M
Source Dataset NameHot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29958
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (72.22%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)60.1987Long. (o)-125.5127Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079374Metagenome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209172_1000271617F079374GGAGMTKKQMNEDHALPSLSLVFGYTAVKELQRLEDRIAVLTRLGYGISEIATICDTTPATVRTIKSSLNKKKRNRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.