Scaffold Ga0208045_1114925

Overview

Basic Information

• Taxon OID: 3300025306
• Scaffold ID: Ga0208045_1114925
• Source Dataset Name: Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 580
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 50.0621
  • Long. (^o): -124.7214
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032872	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208045_11149251	F032872	N/A	GMTAPNDLREAYTGQKRGPQAGFASCLSNSASKCLTADGDGLGMPEPNTDRAVAGEALEGLPGSKSVARAAEAARNQGDPAGSRRTNYEGQAGRGVQRPEERPEASQGVGFVHSSPWQDASLEAGEGTNRLTKHAQATRCRKNDGSTPANLPAGDKPRVSLRSPVRANRTPGSVRGAPGNRCPYLDISISNID