Scaffold Ga0208450_1134925

Overview

Basic Information

• Taxon OID: 3300025301
• Scaffold ID: Ga0208450_1134925
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 43.02
  • Long. (^o): 8.37
  • Depth (m): 2641

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042971	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208450_11349252	F042971	N/A	IMDKDHWDDMFNKKYAVSIASVPVETTDNSFDVSTLSAS