Scaffold Ga0208316_1029243

Overview

Basic Information

• Taxon OID: 3300025296
• Scaffold ID: Ga0208316_1029243
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1303
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 38.48
  • Long. (^o): 10.16
  • Depth (m): 2304

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087321	Metagenome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208316_10292432	F087321	AGGAG	MTLDDVFRIALKHFPLCHVGEDTEGEVVIFTGMMVDENQELREMTDEDID