NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207903_1028374

Scaffold Ga0207903_1028374


Overview

Basic Information
Taxon OID3300025287 Open in IMG/M
Scaffold IDGa0207903_1028374 Open in IMG/M
Source Dataset NameMarine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1049
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)17.4274Long. (o)-59.8286Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103073Metagenome101N

Sequences

Protein IDFamilyRBSSequence
Ga0207903_10283742F103073GGAMADSKNHFVHRQDETFVEVDVPGKDLKVLVPDNRYAYGDNESVAQMAQDVVGKHSNDQGAKVAYEQAREQLETTNFEALKREQAIKRVNAKKPKFTLVPDEDASGVLRGMTVFTILHHPSGLQEMKELYYTADQLMYAIGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.