Scaffold Ga0207417_1039015

Overview

Basic Information

• Taxon OID: 3300025278
• Scaffold ID: Ga0207417_1039015
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-82 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 773
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -25.4941
  • Long. (^o): -179.5286

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103402	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207417_10390154	F103402	N/A	VKDEDDLNNVVVDLVCGMTGTDGEYSAYIDTMHKLSAPDPSAFIPFDELTQEWAVEIADTVAEERGFRATLDSQIAAAKVRPTTKPFSWQQPAPSE