Scaffold Ga0208471_1016038

Overview

Basic Information

• Taxon OID: 3300025255
• Scaffold ID: Ga0208471_1016038
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0441 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1086
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: East of Rio de Janeiro, Brazil, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -22.97
  • Long. (^o): -36.95
  • Depth (m): 3906.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004989	Metagenome / Metatranscriptome	416	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208471_10160382	F004989	AGGA	MSIELEDLTTEKERLEGDRKSLLERLQEYQQGLTQTQQQIQAIGGAIQTCNFFIGKIQSPQESEDEKKSSDDDDS