Scaffold Ga0207880_1022255

Overview

Basic Information

• Taxon OID: 3300025247
• Scaffold ID: Ga0207880_1022255
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-91 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1016
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -5.7497
  • Long. (^o): -170.7411

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067834	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207880_10222551	F067834	GGAG	MGTPTALRKERSVLTGTSFANNTTGAITAQMVRQFTESGMGGYGCIYSPVGTPASQTIATATTVVIDWNGNTAGANGPDDTGTVGVSVGSDADFANDRIRIYDKGFFMVNLGIS