Scaffold Ga0207893_1004144

Overview

Basic Information

• Taxon OID: 3300025241
• Scaffold ID: Ga0207893_1004144
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2027
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 10.0693
  • Long. (^o): -99.2557

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028194	Metagenome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207893_10041444	F028194	AGGAGG	MRPEKEEIEKRKKELQKQHDDLLVKINQGKEAIKSMETNLIGLQGAIQQCNWTLELYKEEKDT