Scaffold Ga0208031_1010772

Overview

Basic Information

• Taxon OID: 3300025237
• Scaffold ID: Ga0208031_1010772
• Source Dataset Name: Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1252
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Orkney Island (southeast)
• Coordinates
  • Lat. (^o): -61.27
  • Long. (^o): -43.92
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018623	Metagenome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208031_10107723	F018623	GAGG	MKTYKVSWRKGRHAGAQGIFYPDSVVVQAENEKAAHLKAYDTHEHLMHVNVTEMNESNV