Scaffold Ga0208206_1033298

Overview

Basic Information

• Taxon OID: 3300025235
• Scaffold ID: Ga0208206_1033298
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP1483 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 683
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South of Fiji, South Pacific Ocean
• Coordinates
  • Lat. (^o): -28.41
  • Long. (^o): 179.14
  • Depth (m): 3501.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020717	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208206_10332981	F020717	N/A	ISIVACTRFLALLETTQCWDFLRPHHILHENKDIWCFRDLNEQKDISISALILMLSEN