Scaffold Ga0208336_1004349

Overview

Basic Information

• Taxon OID: 3300025221
• Scaffold ID: Ga0208336_1004349
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0372 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3456
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: East of Porto Seguro, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -15.83
  • Long. (^o): -33.41
  • Depth (m): 4003.17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096028	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208336_10043491	F096028	N/A	SHITISVDFRVDWASFELIDGDFHSHSFGGSVKRNDLMLEEN