Scaffold Ga0208470_1028951

Overview

Basic Information

• Taxon OID: 3300025219
• Scaffold ID: Ga0208470_1028951
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0740 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 856
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -31.81
  • Long. (^o): 6.84
  • Depth (m): 4001.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007608	Metagenome / Metatranscriptome	348	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208470_10289511	F007608	N/A	SMYPKIRQQVTDRIATFEKVIEEHAVAQKEALKMIYEQLEEAKNDLKYLDEVN