Scaffold Ga0208470_1008605

Overview

Basic Information

• Taxon OID: 3300025219
• Scaffold ID: Ga0208470_1008605
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0740 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1832
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -31.81
  • Long. (^o): 6.84
  • Depth (m): 4001.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066848	Metagenome / Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208470_10086052	F066848	AGGA	MRFSTRSIHSLRHPQDDVYRAVSTEVGPGFAMGSSDYVLRTVLKGARQIAADQRLPVDPVAKGAGSEPELNLVA