Scaffold Ga0208058_1034179

Overview

Basic Information

• Taxon OID: 3300025210
• Scaffold ID: Ga0208058_1034179
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP1092 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 664
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Indian Ocean
• Coordinates
  • Lat. (^o): -29.81
  • Long. (^o): 82.62
  • Depth (m): 4000.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014192	Metagenome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208058_10341792	F014192	N/A	DFLFLYLDCVLFLTFEIKNNKIENVKKFINVKLYGAKPRIVIAPSKKGAKNITNNLLLSLAIKLKSLLLIN