NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209645_1043714

Scaffold Ga0209645_1043714


Overview

Basic Information
Taxon OID3300025151 Open in IMG/M
Scaffold IDGa0209645_1043714 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1598
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087879Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Ga0209645_10437142F087879N/AMIDSYTKEKWNKIDTVKDLLNFIEDPKCDVMGMSSELVDIGKSSFWTAANVSFDFDVQEILKSQPEIKHNQLSETTMVPSELKKHKENNYGNGYDRIKPDTNIWKIVKALGFGDNSSVWVNNQPPGSIMGRHVDFISCFTYENIGEDNVLHSMKYDKDLRQPKELKTIWRCFVALDDWKPGQIVNFEPNFWTEWKKGDVVFFDWRNTPHTTSNGGFDQRPFLKITGVLDDDTWIIEAKNNGNIKKVSVD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.