Scaffold Ga0209725_1006285

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209725_1006285

Scaffold Ga0209725_1006285

Overview

Basic Information
Taxon OID	3300025144 Open in IMG/M
Scaffold ID	Ga0209725_1006285 Open in IMG/M
Source Dataset Name	Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5519
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (90.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Indonesia: Gulf of Boni
Coordinates	Lat. (^o)	-2.75	Long. (^o)	121.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079543	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209725_10062852	F079543	GGAGG	MANELARQLGELPFTKLNPLSFRTEIAGLSDTELEKHPVRVWVEIEDVSKVVKIAGFARVLRVYPHLSFVYVATYARELASLVASDLVRSVWNDLPVRAEGCLVVPETDPDTVAVATRPDRGAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.