Scaffold Ga0209336_10015774

Overview

Basic Information

• Taxon OID: 3300025137
• Scaffold ID: Ga0209336_10015774
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2820
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (81.82%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.2833
  • Long. (^o): -134.6666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072854	Metagenome / Metatranscriptome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209336_100157743	F072854	AGGAG	VEIIKPLTVMILATSLMALLGLIVYDEFMMANAHGGELDSSVVELLQMAITGVVGIVAGYLSGSSTPPKGNGCNNPDCKC