NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209835_1085094

Scaffold Ga0209835_1085094


Overview

Basic Information
Taxon OID3300025115 Open in IMG/M
Scaffold IDGa0209835_1085094 Open in IMG/M
Source Dataset NameAnoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)818
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameRwanda: Lake Kivu
CoordinatesLat. (o)-1.78Long. (o)29.2Alt. (m)Depth (m)52
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000962Metagenome / Metatranscriptome820Y
F014847Metagenome / Metatranscriptome259Y
F016528Metagenome / Metatranscriptome246N

Sequences

Protein IDFamilyRBSSequence
Ga0209835_10850941F016528N/ANELFAKVLAENPLPYKFGDKVNTNRGIGFISGYNFKDREKVWRFTIRPFGLTNYHTDVETVYGKIE
Ga0209835_10850942F014847GGAMEYESNQQILEELLDNIRTLHEENAKLKQELEHIRELNSELNRKLKSIQALFL
Ga0209835_10850943F000962N/AMNIHVPDEIKLKYPHMEFRGKQRIINDRTVIEAYNHATEQNFYYSFEEDFFWFAGQIPDYKLPKVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.