NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209349_1022174

Scaffold Ga0209349_1022174


Overview

Basic Information
Taxon OID3300025112 Open in IMG/M
Scaffold IDGa0209349_1022174 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2228
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → unclassified Chromatiaceae → Chromatiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007828Metagenome344Y
F042020Metagenome / Metatranscriptome159N

Sequences

Protein IDFamilyRBSSequence
Ga0209349_10221743F007828AGGMLNSLTTIVRSNQNATMIRVGAGSSAIYTIYDLKTQSNTYTGTLNATKKAWNKHYRNSRQFVTKSGANHRYLGS
Ga0209349_10221744F042020AGGMTKPQFNLFESTFDEWLDELSLINHNESPGLRTVLNDLYMEGHEPLDARDALEVYHPEWHEELTYLEEHPIG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.