Scaffold Ga0209398_1000770

Overview

Basic Information

• Taxon OID: 3300025106
• Scaffold ID: Ga0209398_1000770
• Source Dataset Name: Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 18543
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Ash Meadows Big Spring, Nevada
• Coordinates
  • Lat. (^o): 36.37
  • Long. (^o): -116.27
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022216	Metagenome / Metatranscriptome	215	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209398_100077012	F022216	GAGG	VNEPGLKQGPTDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG