NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208159_1003301

Scaffold Ga0208159_1003301


Overview

Basic Information
Taxon OID3300025101 Open in IMG/M
Scaffold IDGa0208159_1003301 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5379
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED211(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.198Long. (o)-77.499Alt. (m)Depth (m)38
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002593Metagenome / Metatranscriptome545Y
F024924Metagenome204N

Sequences

Protein IDFamilyRBSSequence
Ga0208159_10033016F024924AGGAGMDGKKRLNKSDRALAQDKFEQVQQAKNRIIVSFNCEEKAKRYLKSEGYRYQEVYSFKEDRALLYKNFKNSWVKLASKFDYLNDNTLEMGTVWVIETL
Ga0208159_10033018F002593N/AMEIVNMSKLIYSRNGSETTESIDNAQPQIRAIWNQAHRFGANIVRVRAEKNRFGADTGRTFNSFHHGKVSIYKQKDQVHESNALYFARKIPLTKVNKGMQILEVASSLDVQDTLDTVDAIQYYSETSFLGRLWNRIRYGTPMSITA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.