NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209616_1000287

Scaffold Ga0209616_1000287


Overview

Basic Information
Taxon OID3300025091 Open in IMG/M
Scaffold IDGa0209616_1000287 Open in IMG/M
Source Dataset NameFreshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15136
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019119Metagenome / Metatranscriptome231N
F065559Metagenome / Metatranscriptome127Y
F067648Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0209616_100028723F019119N/AMLELSAQIAKEHYELTDNVDRNLNYLWYMYHKGSKVGTFRPFVYMAELQLLKRMGYINDTEIKNMIAMLESSDQENLHMVTLSIKSFRDLRVKEHGEYSKVNQAYWKIAKDYPHEILNHEVFMQTMAAK
Ga0209616_10002876F067648N/AMTRDELKNLINMFQSSDAENHVVAFHAIENSPLDNNELVLLYKFSGQVFAKWKHEIPMTAQRIADVIGDEAIALSSARVLGIITNNKADKHVIETFLEFFIRDLTSMLGSIGYPMDKVDINVKIRDYGQSTES
Ga0209616_10002879F065559N/ALAGFTKSNSMKEMDMIGTLVRLADLGVTGIKVTYEGSGDSGAIENVVYTAEKLKENEEDAFEDLNDLDVWGTDILNLSTLDSGLESDIAHFVEEQLLNDIEDWWNNDGGYGNVCILVPSGKYKIVNDIRVTEVETFYHEGSLIQKTL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.