Scaffold Ga0207890_1029445

Overview

Basic Information

• Taxon OID: 3300025079
• Scaffold ID: Ga0207890_1029445
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1010
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0005
  • Long. (^o): -144.9964

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076594	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207890_10294453	F076594	GGAGG	MPYVGRDLSIGDRKILTPTGSTPATTYTLQNASVDYYPSAAQ