Scaffold Ga0209615_101404

Overview

Basic Information

• Taxon OID: 3300025075
• Scaffold ID: Ga0209615_101404
• Source Dataset Name: Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1669
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: Indian Creek, Illinois
• Coordinates
  • Lat. (^o): 41.6655
  • Long. (^o): -87.5437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051081	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209615_1014044	F051081	N/A	MNLHSQLDHILTQWDIKQSTKRGYNPFALGIYLRQAERIAEAVNQGATISDAIDKHFNDRIAAMLHKKFS