Scaffold Ga0207887_1081812

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0207887_1081812

Scaffold Ga0207887_1081812

Overview

Basic Information
Taxon OID	3300025069 Open in IMG/M
Scaffold ID	Ga0207887_1081812 Open in IMG/M
Source Dataset Name	Marine viral communities from the Pacific Ocean - LP-38 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	525
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	49.9853	Long. (^o)	-145.0838	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042929	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207887_10818121	F042929	N/A	KDKTTALSQIKKAVGARYQGLKGWGGMILPGILIGFYFFIFFLLLSGCSYFKKEKVREVDPLTVPPIEFICKKIDCGDEDIKQLIEEEQNTIACIKLQPECKLDQED

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.