Scaffold Ga0208961_1069197

Overview

Basic Information

• Taxon OID: 3300025051
• Scaffold ID: Ga0208961_1069197
• Source Dataset Name: Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B3 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 647
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102634	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208961_10691971	F102634	AGGAG	MEETIKKRIELEGYGMLDGEFIQNELGWFCREVNGLRWNFREWGDQAAMDTPEEAALYLLSLDLDDTDPDS