Scaffold Ga0209518_1052425

Overview

Basic Information

• Taxon OID: 3300025030
• Scaffold ID: Ga0209518_1052425
• Source Dataset Name: Soil microbial communities from Rifle, Colorado, USA - Groundwater B1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1740
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060838	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209518_10524254	F060838	AGGAGG	MSFQYIEPTDEQKIVMQNFRDKYSSLARSLETVPSSRGLSLALTKLEESAFWLNKAITKN