NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209914_1002961

Scaffold Ga0209914_1002961


Overview

Basic Information
Taxon OID3300024984 Open in IMG/M
Scaffold IDGa0209914_1002961 Open in IMG/M
Source Dataset NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_plan (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12778
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (6.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location
Location NameSouth Africa: Cape Town
CoordinatesLat. (o)-33.927Long. (o)18.452665Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081545Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0209914_100296110F081545N/AMDHQQLRSIIIKLESRLSDDDRERLHFYLGNDVPRKIRDDASLRGTLRLMDSLFDQDKINEQDFTFLIRAFEQIQCRDAVNILKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.