Scaffold Ga0255046_10209458

Overview

Basic Information

• Taxon OID: 3300024519
• Scaffold ID: Ga0255046_10209458
• Source Dataset Name: Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 888
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 49.2166667
  • Long. (^o): -123.5333333
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105204	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0255046_102094582	F105204	N/A	TFSRDFDGARAVLRIEPSQEQPAECMLTDLPAGQGAPWKETTLDPAIHRALLDLLFDDARIPHYQSDTAASVVAEKFVCSTRVGESEFCYVPQVVVTGMSSPWRFGLQAELTLSEQSQELIDEFLSAHEACWGGGTPMD