Scaffold Ga0255049_10020473

Overview

Basic Information

• Taxon OID: 3300024517
• Scaffold ID: Ga0255049_10020473
• Source Dataset Name: Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 3025
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 50.0528611
  • Long. (^o): -123.8211389
  • Depth (m): 425

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070744	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255049_100204732	F070744	GGAGG	MNKRQVPLGRAWLRRYLRDRLKVTVPLNADDDEWQHICHEIPAKDWVRVQKAWRQHLHNDAPRHMQYIHAANEESKRLGLFWQRLIAQDFVTEENALLLAENFFQGLGGYSDEMAKDMVRKILSGAADQYRTKATMTANNLNAVEVARDT