Scaffold Ga0255164_1056228

Overview

Basic Information

• Taxon OID: 3300024495
• Scaffold ID: Ga0255164_1056228
• Source Dataset Name: Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 624
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 31.4271
  • Long. (^o): -81.6053
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096666	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255164_10562281	F096666	N/A	EASDTDILMAPISGRYYLVNKRLEYWIRLYDNGITITNHKFTFSNTSPQMYQDMLIGIVETAIEKSRDEFEAAVFQNEVELLENIIINIKNK