NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209979_1000285

Scaffold Ga0209979_1000285


Overview

Basic Information
Taxon OID3300024353 Open in IMG/M
Scaffold IDGa0209979_1000285 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)75453
Total Scaffold Genes115 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)84 (73.04%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameDenmark: Anholt
CoordinatesLat. (o)56.62Long. (o)11.67Alt. (m)Depth (m)31
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088228Metagenome109Y
F091295Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0209979_1000285106F088228GGAMGEGSFNELELLSQEDLIVETLRKLLRSYAELSRREEVTKDFLENLCSFSLEAHVWRILWEGGTAQRFTDILRVVGCSRGKLSDVLRELLRVGLVRMIGVRYQAVSPAWLVR
Ga0209979_100028592F091295AGGAGGMTSRYGYKEALGRLDKDTRICFKYIEKLINDKFNTAIAVYQPPAPRFGLSKIESQLDSLQKQIDGLRPKVDLAYEIAKDHDGQEAYLKKLTEKAEEMFEDMKEHFKMLYDSGFYKEGQRRKIRAEGLLDARKEKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.