NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255142_1070554

Scaffold Ga0255142_1070554


Overview

Basic Information
Taxon OID3300024352 Open in IMG/M
Scaffold IDGa0255142_1070554 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)528
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032252Metagenome / Metatranscriptome180Y
F048267Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0255142_10705542F048267GGTGGMTDEEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINEDLEAL
Ga0255142_10705543F032252N/AMKLYRYKKDGHLYTLYEQLRPFYNLVAVPYFPNQGVLAKSKRSISMDDFVVVAER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.