Scaffold Ga0244777_10616438

Overview

Basic Information

• Taxon OID: 3300024343
• Scaffold ID: Ga0244777_10616438
• Source Dataset Name: Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 656
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: Columbia River Estuary, USA
• Coordinates
  • Lat. (^o): 46.234
  • Long. (^o): -123.9135

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019119	Metagenome / Metatranscriptome	231	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0244777_106164381	F019119	GGAG	MIESFLGMKFGIYFKFGMEKDIRKEMEELSAKIAEEHYNITDGVDQNLHYLWYMYHKGSKAGMFRPFVYMAELQLLKKMGYINDTEIKNMIHMLESEDQDNLHMVTLSIKNFRDLRLQEHGEYSKVNNAYWKVAKNYAFEILNHEIFMQTMAAK